PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462959694
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family HB-other
Protein Properties Length: 330aa    MW: 36569.8 Da    PI: 4.5693
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462959694genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox30.94.6e-10258309354
                --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
   Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                 R +++k qle+Le+++ +++ p+ +++  + + ++L+ + +  WF  rR +
  462959694 258 ARKRLKKVQLETLERVYLRSKRPTDTMISSIVQVTNLPRKTIVKWFEDRREQ 309
                58999*********************************************65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.479253313IPR001356Homeobox domain
SMARTSM003895.4E-5255317IPR001356Homeobox domain
CDDcd000865.10E-9256307No hitNo description
SuperFamilySSF466893.21E-10256311IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.2E-9258309IPR009057Homeodomain-like
PfamPF000461.1E-7258308IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0002229Biological Processdefense response to oomycetes
GO:0009414Biological Processresponse to water deprivation
GO:0009682Biological Processinduced systemic resistance
GO:0009787Biological Processregulation of abscisic acid-activated signaling pathway
GO:0010118Biological Processstomatal movement
GO:0050832Biological Processdefense response to fungus
GO:2000022Biological Processregulation of jasmonic acid mediated signaling pathway
GO:2000071Biological Processregulation of defense response by callose deposition
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 330 aa     Download sequence    Send to blast
MATVLPLAMP AASAAPTACI SGSPSPASFT GTRAHLSLRF RGSPRGVACA LRRRPTKYKT  60
KIQNDDVATE DDMDDEDEDA ALEAIFKQLE EDLENDDLSV NDEDEISEED MARFEQELAE  120
AIGDVGGAEE SAGDLSSGFG DSGNDDKEAG SEQSELKNWQ LRRLARALKI GRRKTSIKNL  180
ASELGLDRAL VIELLRNPPP KLLFMSDSLP DETPSKPEVK EVEPLSSTIV DEAESSHATE  240
INQEMELPIH VRSAEWSARK RLKKVQLETL ERVYLRSKRP TDTMISSIVQ VTNLPRKTIV  300
KWFEDRREQE GVPDHHAAFR RSLSETVASS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1257265ARKRLKKVQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008659724.11e-158PREDICTED: uncharacterized protein LOC103638651
TrEMBLA0A0A9IZX91e-162A0A0A9IZX9_ARUDO; Uncharacterized protein
STRINGGRMZM2G163641_P011e-157(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP107003542
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11270.17e-58overexpressor of cationic peroxidase 3